Product Description: conserved Plasmodium protein, unknown function
SignalP Peptide: MLNSGGEHVESERRPCLKYLISLLLLLMLMLILR
# Transmembrane Domains: 0
EC Numbers: None
Curated GO (PlasmoDB): None
Expression by stage (LR - Le Roch et al., and MCA - Malaria Cell Atlas):
Stage | LR class | MCA mean | MCA prop. zeros |
---|---|---|---|
Sporozoite | not expressed | N/A | N/A |
Ring | not expressed | 0.02 | 0.99 |
Trophozoite | not expressed | 0.19 | 0.87 |
Schizont | not expressed | 0.08 | 0.94 |
Gametocyte | not expressed | 0.10 | 0.94 |
More info:
Old (Pf3D7v3) Gene ID: PF3D7_1210700
Resistome Missense Mutations: None
Resistome Compounds with Missense Mutations: None
Resistome # Samples with Disruptive Mutations: 0 (0 missense, 0 "interesting" missense)
Zhang Phenotype: Mutable in CDS
MIS: 1 | MFS: -0.751 | #Insertions: 8
PlasmoGEM Phenotype: Dispensable (Pb ortholog: PBANKA_0609200)
RMgmDB ABS Phenotype: Different from wild type (Pb ortholog: PBANKA_0609200)
Modification: Disrupted | RMgm-2091
More info: PhenoPlasm Link
AlphaFill Uniprot ID: Q8I5U2
"Best" AlphaFill ligand hit: No AlphaFill hits
No associated EC numbersNo evidence of orthology to BindingDB entries
MalariaGEN Pf7 (worldwide samples) # unique SNV/indels:
Homozygous genotype calls only
variant type | common | rare | doubleton | singleton |
---|---|---|---|---|
synonymous | 5 | 26 | 15 | 30 |
disruptive | 39 | 68 | 38 | 106 |
missense | 18 | 55 | 30 | 75 |
Any inclusion in genotype call
variant type | common | rare | doubleton | singleton |
---|---|---|---|---|
synonymous | 9 | 53 | 20 | 32 |
disruptive | 58 | 136 | 78 | 174 |
missense | 31 | 99 | 57 | 100 |
PlasmoDB Total SNPs: 161
Non-coding: 94 | Synonymous: 30 | Nonsynonymous: 37 | Stop Codon: 0
Protein Length: 526 | Molecular Weight (kDa): 62.776
UniProt ID(s): Q8I5U2
PDB ID(s): None
Isoelectric Point: 4.81
Protein Domain Annotations:
Source | Family ID | Description |
---|---|---|
InterPro | N/A | N/A |
PFam | N/A | N/A |
Superfamily | N/A | N/A |
PMID | Title | Authors | DOI/Link |
---|---|---|---|
12368864 | Genome sequence of the human malaria parasite Plasmodium falciparum. | Gardner MJ, Hall N, ..., Barrell B | 10.1038/nature01097 |