PF3D7_1210700

Genome location: Pf3D7_12_v3:476,110..479,111(-)

Genome classification: Core

Function and Localization

Product Description: conserved Plasmodium protein, unknown function

SignalP Peptide: MLNSGGEHVESERRPCLKYLISLLLLLMLMLILR

# Transmembrane Domains: 0

EC Numbers: None

Curated GO (PlasmoDB): None

Expression by stage (LR - Le Roch et al., and MCA - Malaria Cell Atlas):

Stage	LR class	MCA mean	MCA prop. zeros
Sporozoite	not expressed	N/A	N/A
Ring	not expressed	0.02	0.99
Trophozoite	not expressed	0.19	0.87
Schizont	not expressed	0.08	0.94
Gametocyte	not expressed	0.10	0.94

More info:

Resistome Mutations

Old (Pf3D7v3) Gene ID: PF3D7_1210700

Resistome Missense Mutations: None

Resistome Compounds with Missense Mutations: None

Resistome # Samples with Disruptive Mutations: 0 (0 missense, 0 "interesting" missense)

Essentiality (ABS)

Zhang Phenotype: Mutable in CDS

MIS: 1 | MFS: -0.751 | #Insertions: 8

PlasmoGEM Phenotype: Dispensable (Pb ortholog: PBANKA_0609200)

Relative Growth Rate: 0.96 ± 0.07
Confidence: 6.82

RMgmDB ABS Phenotype: Different from wild type (Pb ortholog: PBANKA_0609200)

Modification: Disrupted | RMgm-2091

More info: PhenoPlasm Link

Binding Evidence

AlphaFill Uniprot ID: Q8I5U2

"Best" AlphaFill ligand hit: No AlphaFill hits

No associated EC numbers

No evidence of orthology to BindingDB entries

Orthology Information

Ortholog Group (OrthoMCL): OG6_532914

No human ortholog(s)

Genetic Variation

MalariaGEN Pf7 (worldwide samples) # unique SNV/indels:

Homozygous genotype calls only

variant type	common	rare	doubleton	singleton
synonymous	5	26	15	30
disruptive	39	68	38	106
missense	18	55	30	75

Any inclusion in genotype call

variant type	common	rare	doubleton	singleton
synonymous	9	53	20	32
disruptive	58	136	78	174
missense	31	99	57	100

PlasmoDB Total SNPs: 161

Non-coding: 94 | Synonymous: 30 | Nonsynonymous: 37 | Stop Codon: 0

Protein Information

Protein Length: 526 | Molecular Weight (kDa): 62.776

UniProt ID(s): Q8I5U2

PDB ID(s): None

Isoelectric Point: 4.81

Protein Domain Annotations:

Source	Family ID	Description
InterPro	N/A	N/A
PFam	N/A	N/A
Superfamily	N/A	N/A